PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS58402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 236aa    MW: 26736.1 Da    PI: 4.4681
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS58402.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-182667447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      ++eE++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
       EPS58402.1 26 LSEEEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 67
                     69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-22477IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-5416IPR009057Homeodomain-like
PROSITE profilePS500904.17417IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-251772IPR009057Homeodomain-like
PROSITE profilePS5129427.5221872IPR017930Myb domain
SMARTSM007171.3E-162270IPR001005SANT/Myb domain
PfamPF002495.9E-162667IPR001005SANT/Myb domain
CDDcd001673.09E-132768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
GLLRCGKSCR LRWTNYLRPD VKRGLLSEEE EKMVIDLHAQ LGNRWSKIAS HLPGRTDNEI  60
KNHWNTHIKK KLRKMGIDPL THKPLPLQEP ESAVAEKREE NRTAAPAPAA GVEEDEEEEE  120
ERSSTVSKFD ELLLLNVNNP VDFCVDEIPV VDPGEVILFR CDENSSTPTT SSSSSWSSAS  180
SANVPEELRF IDEIFMGDSW YDDLSCLDFL LETDGKLMMM NMDGIGVDSV KEPWKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2247240108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085868.18e-71PREDICTED: protein ODORANT1
TrEMBLS8DGC81e-174S8DGC8_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc11g011050.1.13e-61(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.15e-56myb domain protein 43
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]